SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039603 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039603
Domain Number 1 Region: 21-117
Classification Level Classification E-value
Superfamily Immunoglobulin 4.22e-20
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039603   Gene: ENSMODG00000029578   Transcript: ENSMODT00000042709
Sequence length 122
Comment pep:novel chromosome:BROADO5:1:171423783:171424393:1 gene:ENSMODG00000029578 transcript:ENSMODT00000042709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWICPLICLMLFGEGVISKIALEQQEKAVSVLIGESTTFKCSITGGRMDDYYMSWYRKT
QDNTLIFICQENEVCGSGFQENFQVTIDQDNNKFTLEIIKASMRDRGIYYCTAENTVLQL
HF
Download sequence
Identical sequences K7E1F2
ENSMODP00000039603 ENSMODP00000039603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]