SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039693 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039693
Domain Number 1 Region: 31-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000555
Family V set domains (antibody variable domain-like) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039693   Gene: ENSMODG00000029432   Transcript: ENSMODT00000042799
Sequence length 301
Comment pep:novel chromosome:BROADO5:2:283806156:283818795:-1 gene:ENSMODG00000029432 transcript:ENSMODT00000042799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGTCLWLLLLLLLLFCVSDSQAENVYTMVRYREGETLSVQCSYTVRLDRWEGKVWCKV
RRKKCDSGFSRGSGFSPPYKLHDDPQSGLLTVTMERLRHQDSGKYWCMRNNSRTLYPVKG
IQLVVLRAPSTEKNTPFTTKDTSIQKPDYILRIAVTTGPLLDKVKDLPMIAPITTSVPAS
VGRMPTNTATISLMDTVSRVTMRSTPVTRSVTTAMLRITTRPSVTNGSPSKASVMLVTVK
ARSSSTRSTTTKSHLEKLPPNSFYNSGLAVPMLLGGSFMILMFSVVFYVLWKKKRMGTYY
V
Download sequence
Identical sequences K7E1P2
ENSMODP00000039693 XP_007483919.1.35504 ENSMODP00000039693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]