SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039709 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039709
Domain Number 1 Region: 23-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.12e-26
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039709   Gene: ENSMODG00000028564   Transcript: ENSMODT00000042815
Sequence length 133
Comment pep:novel chromosome:BROADO5:1:170658783:170659957:1 gene:ENSMODG00000028564 transcript:ENSMODT00000042815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSGFSFLILWLQLNGVTSQQKVEQSPLSLEVQEGGNVTVNCTYTNTAVTNLYWYHQY
PGKGPRLLIQTVLNVVTKPKGRFTIHLEKGAKLFSLHISASHSEDSGTHFCAVSPQSFLC
TCSLCTNLKLRFQ
Download sequence
Identical sequences K7E1Q8
ENSMODP00000039709 ENSMODP00000039709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]