SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039773 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039773
Domain Number 1 Region: 90-217
Classification Level Classification E-value
Superfamily SEA domain 2.75e-35
Family SEA domain 0.00098
Further Details:      
 
Domain Number 2 Region: 29-92
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000314
Family SEA domain 0.0059
Further Details:      
 
Domain Number 3 Region: 250-320
Classification Level Classification E-value
Superfamily SEA domain 0.0000000549
Family SEA domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039773   Gene: ENSMODG00000028908   Transcript: ENSMODT00000042878
Sequence length 323
Comment pep:novel chromosome:BROADO5:Un:46969703:46978911:-1 gene:ENSMODG00000028908 transcript:ENSMODT00000042878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDFAEHSWCLLTAAVFGMPTFARSFTVTSNVSFPRPIQNGTATKFLCGHWKTPTTPSLD
RKKIYRELSNQTQGITRLGAYTLDNKSLYLHAGGPNFEPFTLKFTITNMRYTADMGERGS
SIFISTERVLQRLLSSLFEKSSLGSQDFASKLTLLRPMKEGRATLVHFTCIHRRDPASSV
LDREKIYCELSYLTWSITRLGPYTLEKDSLYLNGYNHLAVAPTKMPPDPAVAPGCPLWAT
EPGGSQAASLSFQSFTTIPEVLYTEDMHLSGSDKFNFTKRTLQQPLKNGSETGVSCLYTH
KRNLRSSFRDQEKVYWDAKRAFH
Download sequence
Identical sequences K7E1X2
ENSMODP00000039773 ENSMODP00000039773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]