SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039839 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039839
Domain Number 1 Region: 126-246
Classification Level Classification E-value
Superfamily SEA domain 6.67e-40
Family SEA domain 0.00041
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily SEA domain 2.88e-28
Family SEA domain 0.00091
Further Details:      
 
Domain Number 3 Region: 279-349
Classification Level Classification E-value
Superfamily SEA domain 0.000000157
Family SEA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039839   Gene: ENSMODG00000027434   Transcript: ENSMODT00000042944
Sequence length 352
Comment pep:novel chromosome:BROADO5:Un:32987419:33006227:1 gene:ENSMODG00000027434 transcript:ENSMODT00000042944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKDSIKFKSTEKILQNMLGPLFENSSLGSSYSRCKLTFLRPLKNLTVTEVGVICLYQS
DSTGPFLDRERVYWEFSNQTGGITRLGPYTLDRDNLYLNAPIQTTIPSRISSAPSLLTNS
SASGSFSLKSFTVNFTITNLLCTADMGRPGSQKFKATERVLQRLLSPLLENSSLGSDYSG
CRLTMLRPIQNGTATKFLCGHWKTPATPSLDRKKIYWELSNQTQGITRLGAYTLDNKSLY
LDGYNHLAVAPTKMPPDPAVAPGCPLWATEPGGSQAASLSFQSFTTIPEVLYTEDMHLSG
SDKFNFTKRTLQQPLKNGSASEVSCLCTHKRNHRSSFRDQEKVYWDAKRAFH
Download sequence
Identical sequences K7E238
ENSMODP00000039839 ENSMODP00000039839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]