SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039893 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039893
Domain Number 1 Region: 87-215
Classification Level Classification E-value
Superfamily SEA domain 1.31e-40
Family SEA domain 0.00035
Further Details:      
 
Domain Number 2 Region: 248-318
Classification Level Classification E-value
Superfamily SEA domain 0.0000000275
Family SEA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039893   Gene: ENSMODG00000029193   Transcript: ENSMODT00000042997
Sequence length 321
Comment pep:novel chromosome:BROADO5:Un:20377601:20741657:-1 gene:ENSMODG00000029193 transcript:ENSMODT00000042997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLTSGLLIRESTVYAIASEIGVGPFTHIRDHGSARDMTSVTSESTAGAMGGDAGVVPV
THAQGHEGPGSTGALMRSPLTPVSTVIPTAGSFNSKTFTINFTITNMFYKTKMGQRGSST
FRVAEFVLQHLFKVLFERSSLGSQYSGCSVTLLRSMNNGKATGVEVICSYQEFFSIPVLD
KKKIYQELSQQTNGITRLGGYILDEESLYVDGYNHLAVAPTKMPPDPAVAPGCPLWATEP
RGSQAASLSFQSFTTIPEVLYTEDMHLSGSDKFNFTKRTLQQPLKNGSASGVSCLCTHKR
NHRSSFRDQEKVYWDAKRAFH
Download sequence
Identical sequences K7E292
ENSMODP00000039893 ENSMODP00000039893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]