SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039929 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039929
Domain Number 1 Region: 29-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000151
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 2 Region: 142-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000115
Family C2 set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039929   Gene: ENSMODG00000028202   Transcript: ENSMODT00000043032
Sequence length 368
Comment pep:novel chromosome:BROADO5:2:164625005:164685421:1 gene:ENSMODG00000028202 transcript:ENSMODT00000043032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWKSFTPLIFFTMLQNQGTSGSKMEKIDLAVITGNDIKLQPVWSQQYSESTDFIWFFRP
TSTQNTHKIVSWKNGSKVTFDVDIFQNRLNAIAENLTLFINSVQKQDSGLYYMEITNLKG
EVYTTAQFQVSVYDPVQEPELQVTWEPWNSTLCHVNLSCLVKGNSNLTYIWYRGRKQMNT
VGKYSHIQLLIQAKNTENSFTCHASNPVSSGSHTINLTWACPSSVYSSTSELQLLLILGF
SLIPLTVLLLSILIYLYVKRKKQQQQPVTDMNMTVYEKVDYGKPRRNQVQNFCGKDEHKT
LYATVQLPKQLPASRPADQSKTLYSTVQEPKQKPSSEQMTANSATVYQEVQSPKRLSRKE
LKTFQIYF
Download sequence
Identical sequences K7E2C8
ENSMODP00000039929 ENSMODP00000039929 XP_007481695.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]