SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039935 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039935
Domain Number 1 Region: 33-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000232
Family V set domains (antibody variable domain-like) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039935   Gene: ENSMODG00000028376   Transcript: ENSMODT00000043038
Sequence length 189
Comment pep:novel chromosome:BROADO5:2:283856008:283873477:-1 gene:ENSMODG00000028376 transcript:ENSMODT00000043038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAGGWKSQMLLLLFLCLAALQEPLEEKEECIVEGQNITFGCGYNFGKYFRAIKAWQRL
GASGPFETLAQTMNNNGEPSFIQVGRYLLEDDPPNSMLKVTILELQREDAGLYQCVIYRP
PQVVDILYRPIRLKTCNEFPVYALILVCGLLLFKIVVFSLLLLLLRKARVTGDVAPLTPS
FHPEDNGKQ
Download sequence
Identical sequences K7E2D4
XP_007483921.1.35504 ENSMODP00000039935 ENSMODP00000039935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]