SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039961 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039961
Domain Number 1 Region: 160-223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-17
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 2 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.24e-17
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 3 Region: 222-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000089
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 4 Region: 34-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039961   Gene: ENSMODG00000027755   Transcript: ENSMODT00000043065
Sequence length 373
Comment pep:novel chromosome:BROADO5:2:113919834:113979554:1 gene:ENSMODG00000027755 transcript:ENSMODT00000043065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAAQRTPLALGLFGLPSLLLLLLDLTPARGDCNAPERLHFAVLTGDSAAQQSFPEGSE
VKYTCRPGYQRNFKFPPTRTCLPDGTWSKANEFCQKKQCPNLGELTNGHIKIENDILFGS
TVSFICDEGYVLIGESQSRCEIVEGNKVGWSERLPVCEAIRCDLPPVIDNGQHTGINQDF
FTYGSVVRYRCDATYSLIGNEVIHCTTENMKDGIWSDPPPECKVVRCETPLLPNGYIQSL
RRSSYTYKETVILECNPGFNMIGKEMISCGANNTWIPDIPQCIKDVKPTTVGATTSTTTT
TSSSSSTGGSSSSTGGSSSSTGGSSSSTGGSSSSTSGSSSFANKKENQLITVFLVIPLVI
FTQTGSFSFRNWL
Download sequence
Identical sequences K7E2G0
ENSMODP00000039961 ENSMODP00000039961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]