SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039988 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039988
Domain Number 1 Region: 40-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000692
Family V set domains (antibody variable domain-like) 0.047
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039988
Domain Number - Region: 147-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000218
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039988   Gene: ENSMODG00000027392   Transcript: ENSMODT00000043091
Sequence length 339
Comment pep:novel chromosome:BROADO5:2:169232033:169276585:-1 gene:ENSMODG00000027392 transcript:ENSMODT00000043091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLAYKLVCLQLPRVLCTFVCLLGVWTSGDQSSDTQTSLYGVQGGSILFQLNTSLGKK
MQRVEWSLDSKKSRLPLFSLEPETGNLTLKKSLLWNRYEQRAHVTPTSLRIDNITLEDNG
NYKARIYYEEVITEHSFFLSVYEPILPMIKIISKSQTSDGCNLTLECQILKISNDTTVTW
GSVDIPKRQEESLGLPSNSRTLNLSLPPNLQNSSVTCLAKNPAEQQNSTLKLSDACAEKS
SNPQTPKSQWFIGIFLLVILLGILGIGLLIRRRKEKKKEVMDSPENQRNSDMNIQYAVLR
PSRPEDQNQCQEASEQYPQEGKHLTTIYSEIHNPQIMLR
Download sequence
Identical sequences K7E2I7
ENSMODP00000039988 XP_007481758.1.35504 ENSMODP00000039988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]