SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040018 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040018
Domain Number 1 Region: 28-127
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-29
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040018   Gene: ENSMODG00000027888   Transcript: ENSMODT00000043121
Sequence length 136
Comment pep:novel chromosome:BROADO5:3:432640537:432641574:1 gene:ENSMODG00000027888 transcript:ENSMODT00000043121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAETLTTLARIYLLGLLFSILSGSWAQVKLLESGGKVTHEGQSVTLTCKASGFNFKDYD
MSWHWNPSGNNRQLVASISSKTGSKTEYKPRIQGRAYITRNNEANTVSLTLIQLRKEDSG
IYYCAKLTVLGLRQTP
Download sequence
Identical sequences K7E2L7
ENSMODP00000040018 ENSMODP00000040018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]