SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040025 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040025
Domain Number 1 Region: 655-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 697-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 10 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 10-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-17
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 13 Region: 98-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000772
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040025   Gene: ENSMODG00000027660   Transcript: ENSMODT00000043128
Sequence length 758
Comment pep:novel chromosome:BROADO5:3:501950690:501973072:-1 gene:ENSMODG00000027660 transcript:ENSMODT00000043128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALERDRHTAREVVTFQDVAVDFTREEWRLLTPPQKDLYKEVMLENARNLLTVEGEIRPE
MKTNSTEGSYPVEEMDLQRYIHRDPDDFASREFCVSLQNSSHIENQRMQPEEKSSENNQC
RKTFIHRSSVAGHDRIHTSKDSYECKQYGNTFSESSNFAGYQRIYCGEKPYECNQCVKAF
SMSSHLAIHQRIHTGETPYECKQCGKTFTQRSCLAVHQRMHNGEKPYECQQCGKTFTRTS
SLAIHQRIHTGEKPYECKQCGMTFNQRSHLAVHQRMHTEEKPYECKQCGKTFKQMSYFAV
HQRIHTGEKPYECKQCGKTFNQRSHLAVHQRMHTREKPYECKQCGKTFKQMSYFAVHQRM
HTEEKHYECKQCGKTFKRRSCLAVHQRMHTREKPYECKQCGNTFTCTSSLVVHKRMHTGE
KPYECKQCRKTFTHTSSLAVHQRMHTGEKPYECKQCGKTFTHTSSLAVHQRMHTGEKPYN
CKQCGKTFNQRSHLVVHQRMHTGEKPYECKQCGKTFNQRSHLAVHQRMHTGEKPYECKQC
GRTFTCTSNLAKHQRMHTGEKPYECRHCGNTFTSTSSLVVHQRIHTGEKPFECKHCGRTF
TYTSHLAKHQRIHTGEKPYECKQCGNTFTCTSSLVVHQRIHTGEKPYECKQCGKTFTHTS
GLAVHQRIHTGEKPYECNQCGKTFTCTSSLAVHQRIHTGEKPYECKQCGKTFTDYSSLAR
HQRIHTGEKPYECKQCGKTFNQRSYLATHQRTHLGKVL
Download sequence
Identical sequences K7E2M4
ENSMODP00000040025 ENSMODP00000040025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]