SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040042 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040042
Domain Number 1 Region: 29-131
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-19
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 2 Region: 227-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000605
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 3 Region: 108-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000153
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040042   Gene: ENSMODG00000029273   Transcript: ENSMODT00000043145
Sequence length 394
Comment pep:novel chromosome:BROADO5:4:67986741:68023573:1 gene:ENSMODG00000029273 transcript:ENSMODT00000043145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQLLLYFLILAALSDGMTFHHFYKSILPLTTVTGRLGENVILPCKGEKGPNVLIHWKK
KERNIHSYYNEKDHLELQDPTYTNRTFLFLNEINDGNASLTLKNLNLGDEGVYTCYVATD
NNSQQVEVKLQLGAFTRAVMEYGKQNGDTYLICYLFGAYPFPNIMWTENNATKQESKIEE
ISSQPPISVKSQLNVTDSNSSYQCIIENLVLNQRWIGTWKADTSLKTHGEEISFPCKLKN
EDILPEKNIYVIWSRVENTSSTILASFSNNSGRMVNDNRFSWTTSERNDFSLTLKSPTPT
DNGEYLCNISSLGYTQLTVTQFLGAESYQERSSRLIILITSVVIALIVIIVIVVKYRKKC
RQNGPDTDDARSKRAPVTSREMETRESEKMLTSS
Download sequence
Identical sequences K7E2P1
XP_007493681.1.35504 XP_007493682.1.35504 XP_007493683.1.35504 XP_007493686.1.35504 XP_007493687.1.35504 XP_007493688.1.35504 XP_007493689.1.35504 XP_007493690.1.35504 XP_016288926.1.35504 XP_016288927.1.35504 XP_016288928.1.35504 XP_016288929.1.35504 ENSMODP00000040042 ENSMODP00000040042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]