SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040101 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040101
Domain Number 1 Region: 185-317
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000216
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 2 Region: 6-147
Classification Level Classification E-value
Superfamily YWTD domain 0.0000209
Family YWTD domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040101   Gene: ENSMODG00000029179   Transcript: ENSMODT00000043203
Sequence length 328
Comment pep:novel chromosome:BROADO5:7:9410311:9438665:1 gene:ENSMODG00000029179 transcript:ENSMODT00000043203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLDTEISEKVLTASGRVIDLQLDPLEGYIYWTTMDAVECALLNGFYPVMTVEESSFSNR
QIAGLTMNFEHMMFYWLVQDNFGIEIYQAELCKKRSCMETSISRIISVDLRLSSPVLQYY
SGRLVWISQTDTIYSLDLANSRKTRINKGMDLTMLTAFVVVQPRPFPVDFFMKPDVIPQP
LSRNSFHITGNSSAFCISWNLPGNVNHGNIYYLLKSLALSIVEDLDTPKYCLRDLPPFTE
FDLSVKPYTYWRSAAETLLILHSPESEPSTPENPRIFVTISSNVSLNLTNSEVEVRWDPP
SSPNGILQGYMVSYTLIDYIGVNRKTQE
Download sequence
Identical sequences K7E2V0
ENSMODP00000040101 ENSMODP00000040101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]