SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040113 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040113
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily SEA domain 3.79e-31
Family SEA domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040113   Gene: ENSMODG00000027543   Transcript: ENSMODT00000043214
Sequence length 101
Comment pep:novel chromosome:BROADO5:Un:52166446:52169030:-1 gene:ENSMODG00000027543 transcript:ENSMODT00000043214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQRGSSKFNSIEDGLQPLINSLFRKNSFGSHYFGCRLTLLRSMKNRTATGVDVDCAYHE
DYSIPVLDREKIYWELSEQTHGITRLGPYMIDNESLYVDGE
Download sequence
Identical sequences K7E2W2
ENSMODP00000040113 XP_007506676.1.35504 ENSMODP00000040113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]