SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040138 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040138
Domain Number 1 Region: 98-178
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000026
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 9-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000187
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040138   Gene: ENSMODG00000028005   Transcript: ENSMODT00000043240
Sequence length 180
Comment pep:novel chromosome:BROADO5:4:274107956:274119873:1 gene:ENSMODG00000028005 transcript:ENSMODT00000043240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVSKPRVRLSSPSPVEGASLVVACVIREGTGPVSFAWQHQEPQGSQGALTERSEQTLHL
EPVNRTHTGWYICSAQNEVNRLNSERVYLDVIYGPDEPMITVEPLAISEDSYWASEREEV
TLSCLAPSNPPSRYVWLHDHIQVYSGPTYIIARAHQSHAGHYTCLAHNSYLDTHTQATIQ
Download sequence
Identical sequences K7E2Y7
ENSMODP00000040138 ENSMODP00000040138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]