SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040147 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040147
Domain Number 1 Region: 42-134
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.57e-35
Family MHC antigen-recognition domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 134-230
Classification Level Classification E-value
Superfamily Immunoglobulin 4.01e-28
Family C1 set domains (antibody constant domain-like) 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040147   Gene: ENSMODG00000012706   Transcript: ENSMODT00000043249
Sequence length 278
Comment pep:known chromosome:BROADO5:2:285694200:285701239:1 gene:ENSMODG00000012706 transcript:ENSMODT00000043249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSACCSGVDILISPSHCGLGAGLEKEVEQPGRIFVCGRASEGAREHFTEYFISECYFIN
GTEQVWLVQRYITNGEETVRFDSNVGVFEAVTESGRPDAEHWNSQKEFLENLRAAVDTAC
RHNYKISEPFLVRRRVEPEVLVYPSKTAPVGHHNLLVCSVSGFYPGAVAVTWSVNGQEQR
AGVVSTGLMRNGDWTFQTLVMLEVTPQRGDVYTCHVEHSSLQKPVLVAWSAQSESAQSKM
LSGVGGFVLGLIFFGVGLIVHMRSQKANRGSQPAGLLS
Download sequence
Identical sequences K7E2Z6
ENSMODP00000040147 ENSMODP00000040147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]