SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040166 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040166
Domain Number 1 Region: 77-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000385
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040166   Gene: ENSMODG00000027897   Transcript: ENSMODT00000043268
Sequence length 206
Comment pep:novel chromosome:BROADO5:Un:75773381:75779419:-1 gene:ENSMODG00000027897 transcript:ENSMODT00000043268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAQREKDRESRRSPRCLGPDVASLAARGIMEPPGPGWASRPRPLPGPGRAPSLLLQALL
LPLLLGGAPGAQAVPQVSAPHLVEVLKGEPVTLNCALFRSGSKEKVVLEWFNISRSGAST
LLALAEGRMGSLKKTEDTVPGRNTRFQLLPNGNLQLASAEAGDEQDYMCRFSTGTADRVE
ATIRLRVFGQSLKASWKRGKGRGVAD
Download sequence
Identical sequences K7E315
ENSMODP00000040166 ENSMODP00000040166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]