SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040178 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040178
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-30
Family V set domains (antibody variable domain-like) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040178   Gene: ENSMODG00000029587   Transcript: ENSMODT00000043280
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:524199568:524377387:1 gene:ENSMODG00000029587 transcript:ENSMODT00000043280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLSFCSGSLSQAVVTQPPSASAALGSSARLSCTLSSELSGNNVYWHQQSSG
KPPRYLLYVTSSGGTGRGDGIPERFSGSGSGTNRFLSISNVEPEDEADYFCQSYYYAGGS
YPSTQ
Download sequence
Identical sequences K7E327
ENSMODP00000040178 ENSMODP00000040178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]