SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040190 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040190
Domain Number 1 Region: 65-127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 2 Region: 122-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 3 Region: 6-56
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040190   Gene: ENSMODG00000029096   Transcript: ENSMODT00000043292
Sequence length 217
Comment pep:novel chromosome:BROADO5:Un:99311096:99315056:1 gene:ENSMODG00000029096 transcript:ENSMODT00000043292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSADEVPYGTQIIYSCNADPERGVKFNLIGESTIHCMSDREGNGIWSATPPRCELSAS
SVQCLPPTVSNGYQISAQGPPYFYNGTVAFRCYAGFTLKGSSQIRCSSSGTWDPEAPICE
KACQPPPGILHGQHTGRSVGLLDPGTSVNYSCDLGYSLVGEATIHCTTEGVWKPVVPHCK
GAWVVDLVLVLLLRFPSPDISISCYDGCPFLSTLKSM
Download sequence
Identical sequences K7E339
ENSMODP00000040190 ENSMODP00000040190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]