SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040196 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040196
Domain Number 1 Region: 115-201
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-20
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 215-310
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000037
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040196   Gene: ENSMODG00000029247   Transcript: ENSMODT00000043298
Sequence length 391
Comment pep:novel chromosome:BROADO5:7:49640614:49688114:-1 gene:ENSMODG00000029247 transcript:ENSMODT00000043298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLVALIYMSVLWTSACCLKQEQEELSAKVPGLSVTVVNKDPRKTELTWDNTDNITTPT
YVMETHNSPVMDENYIKKVCCHFSTCRATFMHYLAIYQNTSKREVIFNNIGEEDTAATNF
SCLVYNAEFMNCTWTIGRAAPSDVQYHLYSQTAKGKQETECTSYIRNSQARHIGCHFDKL
KEFKGQAYFLINGTSKNVKIKNFCSEKILLLHIEKYNPPSNITVNCSKSNCLIQWQKPKT
RIKFGDSEWDYQLDIQKEGSLDTYELLKIRGTEKNEYEYPLYDTEAKYILKMRTNHRNEN
WSDWSKPIVFGGFKEEKINLIYIYVLVGTAIITLFIFFIFKRYYIMQRLFPQIPQIKDKV
NICEQLNKQIIWEEFKHPEKCEEIMTIDVIG
Download sequence
Identical sequences K7E345
XP_007501082.1.35504 XP_007501083.1.35504 XP_016280300.1.35504 XP_016280301.1.35504 XP_016280302.1.35504 XP_016280303.1.35504 ENSMODP00000040196 ENSMODP00000041301 ENSMODP00000040196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]