SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040260 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040260
Domain Number 1 Region: 42-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.51e-19
Family MHC antigen-recognition domain 0.0000867
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-18
Family C1 set domains (antibody constant domain-like) 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040260   Gene: ENSMODG00000029544   Transcript: ENSMODT00000043364
Sequence length 264
Comment pep:novel chromosome:BROADO5:2:270426037:270430980:-1 gene:ENSMODG00000029544 transcript:ENSMODT00000043364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEQSLGAPLFLLLLQASVLLSLPWEDTPGLTSFLGNSLHNYTFSHTFFCQNEAPMVSL
SEAFGGDQLFSFDFSKNSRVPRLPEFAPWAGDQSDLQAIDRDKQLCQELQKALSNFLEGQ
IPEARGNPVAEVFTQEPLEFGKPNTLICFISNLFPPNIMVTWQHDGEPVTGSSPVFLSAV
DGLGFQAFSYLNFTPSSTDIFTCRVSREGNLFSTIAFWVPQNPIPSTLLENILCGIAFGL
GILGIIVGVALIIYFRKPCACGAD
Download sequence
Identical sequences K7E3A8
ENSMODP00000040260 ENSMODP00000040260 XP_007483723.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]