SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040262 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040262
Domain Number 1 Region: 25-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000687
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 
Domain Number 2 Region: 145-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000279
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040262   Gene: ENSMODG00000028977   Transcript: ENSMODT00000043366
Sequence length 280
Comment pep:novel chromosome:BROADO5:4:73575796:73597484:1 gene:ENSMODG00000028977 transcript:ENSMODT00000043366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSMMFLLQPFLFFLLRAEEKAPDSVFVMKSPETAFLGNNITLKCNLAITTATVLQITWQ
KLKGRTPENIGTYSTMYGEKIHPPYNKHFYYSSSTELTSSSVTIQNVTLEDEACYKCLFN
VFPNGIHGGQICFSVQAVSELRTEIQPQSIIKATVTVICSATGKPAPQITFSNRRVLIGS
PTACIDQNPDGTATVTQWYNISLEAVRNLKLQNVSCDMDHPQGKRTALVSLPQKEDYKKS
GDQQVIYNNSPWRSRTPLIGVPILSILICLAIWFVIKEKK
Download sequence
Identical sequences K7E3B0
ENSMODP00000040262 ENSMODP00000040262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]