SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040272 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040272
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-17
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040272   Gene: ENSMODG00000029664   Transcript: ENSMODT00000043376
Sequence length 271
Comment pep:novel chromosome:BROADO5:3:434066698:434086518:1 gene:ENSMODG00000029664 transcript:ENSMODT00000043376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVSSSATFLSSFLILLLLETHTLASEQFSVIGPTEPIQAWVGRKADLPCYLSPQKNAQ
AMKVIWFQSLEIVHHYEDGRDKFDDQSPKFQGRTELVKDAITRGNVTLRIWNITAADKGH
YKCHFDDGLYQEEAGIELFVSGEGTEQQIPRWSIITAFFIVYWILTFTSVVVFIQRFRKY
FPQDFPWMLDVNGIITVASAFEISFVICYLWVMQSCEGFIYREKWKWMDSFIWTIFLAFT
VSSTVRLGIQLLFFSYLFLKYAYHFCLLLGH
Download sequence
Identical sequences K7E3C0
ENSMODP00000040272 XP_007488706.1.35504 XP_007488707.1.35504 ENSMODP00000040272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]