SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040293 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040293
Domain Number 1 Region: 254-374
Classification Level Classification E-value
Superfamily SEA domain 2.22e-41
Family SEA domain 0.00029
Further Details:      
 
Domain Number 2 Region: 618-738
Classification Level Classification E-value
Superfamily SEA domain 6.41e-41
Family SEA domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040293   Gene: ENSMODG00000029386   Transcript: ENSMODT00000043397
Sequence length 1013
Comment pep:novel chromosome:BROADO5:Un:49921154:49980003:-1 gene:ENSMODG00000029386 transcript:ENSMODT00000043397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHSPKHAVIQLSTLLITGSSAESKGKIMTTAGEPETIMTTTSSPAVRTHSVLATTVSTT
ASDIDLEKITVPASSALPETMVAPAAWSGVEISPSETTLIAEISTPPGAGTGGGSPIGVP
SHPATPDTTASTTAFPWTNVPPAGSTSTSATSLSSVSREDPKPMTSLDTVISETTAMATA
REGPALTESTAMMDISRGAEAVVLSTSDLPTSSAAPLIPTDKVSTQTTMTTIADTAPSLT
PSPSSSTAASGRPRRERFTMNFTINNMLYTEDMEHPYSEEFSSTERILQHLLRGLFKNSS
LASSYIGCTLTSLRPMKEGEATGVDVVCAHYKGFTSPVLDPVKVYWELSNQTYGITRLGP
YTLDRDSLFLNGYNDKEISSISSSSAESKGKIMTTAGEPETIMTTTSSPAVRTHSVLATT
ASTTASDIDLEKITVPASSALPETMVAPAAWSGVEMSPSETMFIAEGSTLPGTGTEGGNS
IGVPSHPATPDTTASTTAFPWTNVPPAGSTSTSATSLSSVSREDPKPMTSLDTSASETTA
MATAREGPALTESTATMDISRGAEAVVLSTSDLPTSSAAPLIPTDKVSTQTTMTTIADTA
PSLTPSPSSSTAASGRPRRERFTMNFTINNMLYTEDMEQPYSEKFSSTERILQHLLRGLF
KNSSLASSYTGCTLTSLRPMKEGEATGVDVVCAHYKGFTSPVLDPVKVYWELSNQTYGIT
RLGPYTLDRDSLFLNGYNDKEISSISSSSAESKGKIMTTAGEPETIMTTTSSPAVRTHSV
LATTASTTASDIDLEKITVPASSALPETMVAPTAWSGVEMSPSETTLIAEISTPPGAGTG
GGSPIGVPSHPATPDTTASTTAFRWTNVPPAGSTSTSATSLSSVSREDPKPMTSLDTSAS
ETTAMATAMEGPALTESTATMDISRGAEAVVLSTSDLPTSSAVPLIPTDKVSTQTTMTTI
ADTAPSLTPSPSSSTAELNRSMPSSMNIFDTSLPHDTVAPSDDSSDSTMTSGQ
Download sequence
Identical sequences K7E3E1
XP_007506635.2.35504 ENSMODP00000040293 ENSMODP00000040293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]