SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040423
Domain Number 1 Region: 528-713
Classification Level Classification E-value
Superfamily Fibronectin type III 6.46e-28
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040423   Gene: ENSMODG00000029109   Transcript: ENSMODT00000043530
Sequence length 737
Comment pep:novel chromosome:BROADO5:8:214722163:214740999:1 gene:ENSMODG00000029109 transcript:ENSMODT00000043530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLGGGTHDAEFHRKIPEKEYPHTMALASTMQIPALGRPLYLGTLYDCRTDTFIPGITL
WDRETLESNVTREEQYKTEFDILTSDSLGAKTNAMNIHGDLKASVLGGMVDIGGSAKYLR
DTKTSKKLVRMTLKYSMTTQYCHLTMNHLGYQNISYPDVFDKGTATHVVTAVLYGAQAFF
VFDQKVSTNERDKDIEGSLKAEVEKIPKVAINLGGEIKKENNEKISSQEFKCTFYGDFVL
ENNPVTYEDAVKIYSSLPKLLRGHGVPLQVWLYPLEKLNSKAAKLARGISISLICEAQDT
LEELCEYNKKCNDMLKASELFVFCATKEKLRLFQELNKQHSQILQKEIAMVLPLIRMGRT
EEDKLANTLTRESQSPFSSRRLSEFLDQTSLEIKVVNSYLTLLKEVRVIADQNELEDMVL
GSPHQFVLVFAFTFLHEEPFLADWKQWLRNPDSSSPRCEQKAYSSWVKDNETRKKVNQLA
ESFSKFAKANHSSEKTQLLVASVADQETKGVSIHLYEKGLLVSTSFELPVKPPPPQIGGV
THDCVELILTSASGKNKITGYQVEYQVVGEDDWTTIPVSGKPEEFKVRGLQPSTEYVFQC
ANVCEVGRGESSDVSCAVRTLPPTSPPGKPKAVVVGPQCVSLQWQGPSVVGAGVKIKEYR
IEYREKTEAVSEEGEGEWCEHRTGNDKMDCAIDGLTPQTVYWFRVSAVYDSSWRSESSEK
SDPVMTLSTTEEATDSG
Download sequence
Identical sequences K7E3S1
XP_007504632.1.35504 ENSMODP00000040423 ENSMODP00000040423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]