SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040428 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040428
Domain Number 1 Region: 136-197
Classification Level Classification E-value
Superfamily SEA domain 2.35e-20
Family SEA domain 0.001
Further Details:      
 
Domain Number 2 Region: 41-102
Classification Level Classification E-value
Superfamily SEA domain 4.84e-16
Family SEA domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040428   Gene: ENSMODG00000028827   Transcript: ENSMODT00000043535
Sequence length 197
Comment pep:novel chromosome:BROADO5:Un:101715855:101717609:-1 gene:ENSMODG00000028827 transcript:ENSMODT00000043535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNFNSGFYDSNPNPFFTGPLVVSYAIILSYFNDPINASFPRPVKNLTATTVDTICLYQRD
STGPFLDRERVYWEFSNQTGGITRLGPYTLDRDSLYLNGYNHHLQSSTSTPLQTTIPSRT
SSDPSLPPSSSASGSFSLKSFTLNFTITDLLYTEDMGRPGSQKFKATERVLQRLLSPLLE
NSSLGSDYSGCRLTMLR
Download sequence
Identical sequences K7E3S6
ENSMODP00000040428 ENSMODP00000040428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]