SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040551 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040551
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000167
Family V set domains (antibody variable domain-like) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040551   Gene: ENSMODG00000029774   Transcript: ENSMODT00000043656
Sequence length 242
Comment pep:novel chromosome:BROADO5:2:283597896:283613672:-1 gene:ENSMODG00000029774 transcript:ENSMODT00000043656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFLLFQILNMWLPSLLILLSLTELSQAHNTTVLQAMEGQSLSISCPYDRAKYWGQLKS
WCRHHEQEEHCQHVVSARRSWLLAFLKKWNGSTAIMDDALAGRLTITLKDLRPQDTGLYQ
CQGHQDGVADTLKKVMVEVLEDPFEPQSSEDSWIPEETQILEETQNPEEPKVQSSISRSL
SKTGHTLSSTVFIFFVAGLLLIKLLAIVILWFATWQRRQKMKPESRHNNIYQLQPLSGQD
EV
Download sequence
Identical sequences K7E449
ENSMODP00000040551 ENSMODP00000040551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]