SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040572 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040572
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-20
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040572   Gene: ENSMODG00000029031   Transcript: ENSMODT00000043677
Sequence length 145
Comment pep:novel chromosome:BROADO5:4:416316498:416377918:-1 gene:ENSMODG00000029031 transcript:ENSMODT00000043677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTLCISFFFTVLPSHTCGNPGRLPNGIQQGTTFNLGDKVRYSCNTGFFLEGHAVLTCHA
SSENSATWDFPLPTCRADDACGGTLRGQSGIISSPHFPSEYGNNADCTWTILAELGDTIA
LVFIDFQLEDGYDFLEVTGTEGSSL
Download sequence
Identical sequences K7E470
ENSMODP00000040572 ENSMODP00000040572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]