SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040597 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040597
Domain Number 1 Region: 111-193
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-20
Family I set domains 0.002
Further Details:      
 
Domain Number 2 Region: 192-293
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-20
Family C2 set domains 0.00073
Further Details:      
 
Domain Number 3 Region: 304-399
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-18
Family I set domains 0.0018
Further Details:      
 
Domain Number 4 Region: 479-561
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000635
Family I set domains 0.0021
Further Details:      
 
Domain Number 5 Region: 402-483
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000163
Family C2 set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040597   Gene: ENSMODG00000028933   Transcript: ENSMODT00000043702
Sequence length 623
Comment pep:novel chromosome:BROADO5:3:431064554:431076842:-1 gene:ENSMODG00000028933 transcript:ENSMODT00000043702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFPPPAPHPEIPGNLLRRGRREISGKAALPRPLPPPHPPPPRRPSFSPAPNYHGEIIKG
TPALRLRIQLSRLTGSSANMRVSRHLPALALLWLFPLLLPSGAQENGSDLQVWVHPPNPV
ILSGDSVVLNCSTNCPTEAKIGLETRLPKIVEDQGKNWRAFRLRNVTRDDSPWCFVNCPT
KNQSSTRTHILVYEPPKKVTLNLEPSQEQSWIPVGQNFSVSCQVAGGRPRENLKMVLLRG
DQEISSQLVPKNTLDTATVMFYPIASREDNEANFSCRASLDLRAKGLTLYQNSSIPRKLS
TFALASEPPVLVAPKLLEAGSKEQVSCEMDKLFPVEKAHIQLTWGGQVLTQVNVIQHADM
LRATATIMTSQEVEADEELTCSVNLGGETRKKSENVIVYTFPQPSLVASGPVQEGNRVNL
TCEARPRARVQINGAPPDEPNRISLIVGEKDNGRLFICQAFLKLREETLQKNRSLELNVQ
FPPKLDEECPGHWNWQEGTEQTLRCVARGNPAPTVRCVPESQQNGMPLGLLHRVTRDHNG
TYHCTAENSIGKAVKVVTVKVEFQDVNWTPIIIIVLVMVLVGSILAIFGYFYYRQQRIRS
YELRKAEEERSMKLMNAEGLASA
Download sequence
Identical sequences K7E495
ENSMODP00000040597 ENSMODP00000040597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]