SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040654 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040654
Domain Number 1 Region: 28-127
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 124-211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-21
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040654   Gene: ENSMODG00000029241   Transcript: ENSMODT00000043761
Sequence length 212
Comment pep:novel chromosome:BROADO5:7:173132823:173134880:-1 gene:ENSMODG00000029241 transcript:ENSMODT00000043761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVQSAAIRIQASYRGHRSRKELKEKGPPRVLQPLQDVVLIEGSAAKLSCRISAFPDPFIR
WSKDGKELRDGPKYRYVFEDPDVVALVVRDGELADLGQYSINVTNPFGECSDSARILVEV
PAKIKKGPDNAKARKGTTVTLTAEILGEPPPDVGWTKDGQDIDEDDRVFYEIGSTTTTLT
IRRATAEDSGKYEVYVENSLGMDQSFARLDVA
Download sequence
Identical sequences K7E4F2
ENSMODP00000040654 ENSMODP00000040654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]