SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040667 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040667
Domain Number 1 Region: 155-241
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-17
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 241-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000192
Family C1 set domains (antibody constant domain-like) 0.06
Further Details:      
 
Domain Number 3 Region: 44-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000019
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040667   Gene: ENSMODG00000028235   Transcript: ENSMODT00000043774
Sequence length 394
Comment pep:novel chromosome:BROADO5:4:369883228:369900576:-1 gene:ENSMODG00000028235 transcript:ENSMODT00000043774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPFSEHPHSGWKALGRGSWKGLLMAASILHCWMPPRSAQGTPVSIVPRPPYGTVGSNVT
LTIEGFSERALSYNWYRKTTENSNRIVSYSTLTGVQKPTDIRERVQPRGFLFIPHLTLGD
DDLYVVQIVDSRGVIAAIVRGKLPVYEKLAKPNITVSSTNVGENDSLELTCSTENKGVNI
LWLSNNQPLALNDKMHMTHDNQTLTIMSVKRTDAGSYQCEAGNPVSTNRSDSQILTVNYG
PDHIEILPSPENGEIKVQFNTSLTLECRALSYPSVHYEWQDINGSVHSGSTFMVNPTSWE
QKKYTCWARNNMTNSSISKDITIHVVEVKFSEVARNRKILFGMAPILVLISVLIFKWTES
IRSCSMSSNARDRLSQIRSCPGQRKVEKKLKKVD
Download sequence
Identical sequences K7E4G5
ENSMODP00000040667 ENSMODP00000040667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]