SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040672 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040672
Domain Number 1 Region: 167-263
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-26
Family C1 set domains (antibody constant domain-like) 0.00097
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-23
Family C1 set domains (antibody constant domain-like) 0.0001
Further Details:      
 
Domain Number 3 Region: 97-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000166
Family C1 set domains (antibody constant domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040672   Gene: ENSMODG00000029124   Transcript: ENSMODT00000043779
Sequence length 340
Comment pep:known chromosome:BROADO5:1:297433118:297451906:-1 gene:ENSMODG00000029124 transcript:ENSMODT00000043779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGCLVTSYFPEPVTVTWNSGTTTSGIQTYPSVLQPSGLYTLTSQLTIPADSWSSQSYT
CNVAHPATSTKIDKKIEATTTTCPCCKCNTVDAGGPSVFVFPPNPQDVLKLSRSPKVTCM
VVDVVSNLPVVHQEWLKGTSYTCKVNTSELPVVERKTISHTKGERKKPDIYVFGPHPDEL
KQKDDVSITCLVTNFFPEDVVIEWQKNNNPESEDKYYTTPTTREKSTYFFYSKLIVKKRD
WDNQNSYTCVVLHEAFPNQISQRTISASPELIPDENCAETRDGELDGLWTTISIFITLFL
LSVCYSATVTLFKVKWIFSSVVELKQPMIPDYRNMMGQGA
Download sequence
Identical sequences K7E4H0
ENSMODP00000040672 ENSMODP00000040672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]