SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040675 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040675
Domain Number 1 Region: 428-553
Classification Level Classification E-value
Superfamily SEA domain 4.97e-40
Family SEA domain 0.00028
Further Details:      
 
Domain Number 2 Region: 298-423
Classification Level Classification E-value
Superfamily SEA domain 4.32e-39
Family SEA domain 0.00032
Further Details:      
 
Domain Number 3 Region: 579-699
Classification Level Classification E-value
Superfamily SEA domain 4.32e-38
Family SEA domain 0.00039
Further Details:      
 
Domain Number 4 Region: 123-248
Classification Level Classification E-value
Superfamily SEA domain 1.06e-30
Family SEA domain 0.00052
Further Details:      
 
Domain Number 5 Region: 2-77
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000109
Family SEA domain 0.0022
Further Details:      
 
Domain Number 6 Region: 732-802
Classification Level Classification E-value
Superfamily SEA domain 0.000000112
Family SEA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040675   Gene: ENSMODG00000029493   Transcript: ENSMODT00000043782
Sequence length 805
Comment pep:novel chromosome:BROADO5:Un:20187604:20249194:-1 gene:ENSMODG00000029493 transcript:ENSMODT00000043782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLGSHYSACSVNLLRSLKNGTATGVDVLCTFQEDSSNPVLNKEKVYWELTEQIQRRRL
KHVLIERDSLFVDGYHHKQPGIISTKKSEIAVGPVTHIPDHGAPGDMTSVTSSLYESTVG
AIAAGSSYSKTFTLNFTITNMFYTPDMGERGSNTFKAAENVLQVLLKFLFGMSNLGSHYS
ACSMNLLRSLKNGTATGVGVLCTFQGDSSNPVLNKEKVYWELTEQIQRRRLKHVLIERDS
LFVDGYHHKQPGIISTKKSEIAVGPVTLIPDYGAPGDMTSVTSGLLTYESTVGAIASESS
YLKVFNLKFTILNLFYTTDMGQRGSSKFNSIEDVLQPLINNLFRKSSFGPHYFGCRLTLL
RSMKNRIATAVDVECAYQEDSSAPVLDREKIYWELSEQTHGKTKLGPYILHKESLYVDGY
THQIPTTTTNTWRPSLEAFTLNFTITNLLYTEDMGQKDSIKFKSTEKILQNMLGPLFENS
SLGSSYYRCKLTFLRPLKNLTVTEVVVTCLYQSDSTGPFLDRERVYWEFSNQTGGITRLG
PYTLDRDSLYLNAPIQTTTPSRISSAPSLLTNSSASGSFSLKSFTLNFTINNLLCTADMG
RPGSQKFKATERVLQRLLSPLLENSSLGSDYSGCRLTMLRPVQNGTATKFLCGHWKTPTT
PSLDRKKIYRELSNQTQGITRLGAYTLDNKSLYLDGYNHLAVAPTKMPPDPAVAPGCPLW
ATEPGGSQAASLSFQSFTTIPEVLYTEDMHLSGSDKFNFTKRTLQQPLKNGSASGVSCLC
THKRNHRSSFRDQEKVYWDAKRAFH
Download sequence
Identical sequences K7E4H3
ENSMODP00000040675 ENSMODP00000040675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]