SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040690 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040690
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000117
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040690   Gene: ENSMODG00000027867   Transcript: ENSMODT00000043796
Sequence length 139
Comment pep:novel chromosome:BROADO5:3:433983371:434073880:1 gene:ENSMODG00000027867 transcript:ENSMODT00000043796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLPCYLSPQKNAQAMKVIWFQSLEIVHHYEDGQDKFDNQSPKFQGRTELVKDAITRGN
VTLRIWNITAADKGHYKCHFDDGLYQEEAGIELLVSEPNPTSKYSTSRIDAGKTIIFFIL
EIVFLLLKHLSDIISLHFS
Download sequence
Identical sequences K7E4I8
ENSMODP00000040690 ENSMODP00000040690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]