SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040783 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040783
Domain Number - Region: 33-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0015
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040783   Gene: ENSMODG00000029674   Transcript: ENSMODT00000043891
Sequence length 242
Comment pep:novel chromosome:BROADO5:8:17634783:17664092:1 gene:ENSMODG00000029674 transcript:ENSMODT00000043891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGFLSLILLPWILQPGGGQFVTHLDAPIQVTLAHWNLSLTCSVTYQNTPTFKNYRFSY
YHIDLEGRKSPLTFTSCLTRPGLENQTHWELCPFTLTELHSVSATGTYYCQVEWPSITKT
GSGIFVLVRDAGYKEPPEGSKKLLLLIFTGLLTVLSILGTVLLLWKAKKQRTSARKMLKR
EAPGRADGCADAKQDQAGSLYTALQPHQPDTYDCLRGDDCCPATQGQRRVGPEDFNTIYE
NF
Download sequence
Identical sequences K7E4T1
ENSMODP00000040783 XP_007502862.1.35504 ENSMODP00000040783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]