SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040808 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040808
Domain Number 1 Region: 22-110
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-23
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040808   Gene: ENSMODG00000028464   Transcript: ENSMODT00000043916
Sequence length 113
Comment pep:novel chromosome:BROADO5:1:171259408:171260183:1 gene:ENSMODG00000028464 transcript:ENSMODT00000043916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKYFSASFLICLHLGWVSCQQKVEQSPPTQSVQEGENTTFSCHYSDSASKGLQWFKKHH
EKGLISLFYIASEGKQKGRLRSTINRKELLSSLYITDSQPEDSGTYLCAVEPQ
Download sequence
Identical sequences K7E4V6
ENSMODP00000040808 ENSMODP00000040808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]