SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040812 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040812
Domain Number 1 Region: 159-273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000221
Family Fibronectin type III 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040812
Domain Number - Region: 66-124
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000338
Family Fibronectin type III 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040812   Gene: ENSMODG00000028058   Transcript: ENSMODT00000043920
Sequence length 529
Comment pep:novel chromosome:BROADO5:6:149028840:149064902:-1 gene:ENSMODG00000028058 transcript:ENSMODT00000043920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRQPLLGRNSPHLLPGLGVEEMGPGSSLWMEPPTMRISGKRIFSVQLFIWFCMVSFSGG
QKGAQQLGTLICLNNYINRIHCNWNTTLSRQDRVHQLLFTSKVDSSEKYNCILQMDTCTI
ELPPDKVLTVFDEFTINGHGNVSGVELTYPKDLTYLPRHHIKLDPPSNLQSNVSSRGCIF
SWSPPIEELYMSLSYELALRQHGEAWERARHKDRITGVTVATIEAFEFDPNLIYEARLRC
RLGSQEANEFLDDEEEDFDYRSQWSEWSPVLQFPSPISLDVSLPPQEGPISMIIIFSIFL
FLISLPYILFKLFPRVRKTFYQNVPSPEAFFRPLYTVHNGNFQMWAKSDLLGPQLRRPGA
MDRRALTRDELLGLIFGESISHLSCFPMKSKRVDIMEEEDPCKPRGSHEDATQQNSDSKY
LSAEELENWRLLGVMIDRHGDGDDAQGYSDYPGASQSSSLATRCPHISLKQEDQSLEICS
PSNSDYCTVSGSEMPQALPPGELQDPMASMDQCLPGLHKAGSFLEPSNI
Download sequence
Identical sequences K7E4W0
ENSMODP00000040812 ENSMODP00000040812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]