SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040834 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040834
Domain Number 1 Region: 134-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-31
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 2 Region: 296-364
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-22
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 255-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000812
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040834   Gene: ENSMODG00000027497   Transcript: ENSMODT00000043942
Sequence length 461
Comment pep:novel chromosome:BROADO5:Un:90830212:90835045:-1 gene:ENSMODG00000027497 transcript:ENSMODT00000043942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYADIALCAETAKWSKPEFCNPAFEPEAGLSTLSPVHQETQSHPRAHCHGGMAWRYQT
DCQFSWLCAALLSTLLLLLLGLLTVIILTQLKPTSPPETPPSLLTPQGPSNATNTIIPGI
QGELGSNLTPEPTCGGLLLGPEGSFASPNYPDPYPPNAYCTWHIQVAPDQVVQLKIEAFS
MDDVASCLFDWLEISLEPEEQGNLGSSMVRVCGKVPPAVLTTNASRLRVAFVSASSVGGI
GFRAWYRAVTPREGGCKEDEFPCGHLFCFLPDVLCDGFTNCKDSSDEANCSRKNPDCGGS
LNGLQGTFATPNFPKPYPHQQFCLWQILVPPGLGIVLRFHNFSLEAHQDCGFDYVEVHES
ADTGALNLMERYREKPRRQSGSSGLLTKAPTNSECPLCAKSRARGYSPPRGKPWAAREAK
GRISCYSHAPTFSLASYYLCCILRFTRHFTNIISFNPPPGR
Download sequence
Identical sequences K7E4Y2
ENSMODP00000040834 ENSMODP00000040834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]