SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040836 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040836
Domain Number 1 Region: 446-527
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000853
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 264-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000593
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 107-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000629
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 186-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000105
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 10-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000021
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 331-436
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000103
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040836   Gene: ENSMODG00000028467   Transcript: ENSMODT00000043944
Sequence length 562
Comment pep:novel chromosome:BROADO5:Un:46681239:46780475:1 gene:ENSMODG00000028467 transcript:ENSMODT00000043944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPLSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINRVAPAGSRIQLSPDKRTL
TVSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVTLSC
VADSNPPAQFTWLQNGKSVNNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYA
PVSKPTIVTSNITAVETKDFSLTCQATGQIHTYQWFINGVAPAGSRIQLSPDKRTLTLSR
LTRRDNKGPYECEIRNQFYSNRSDPFTLDVAYGPDIATIDHISDQFTTGINVTLSCVADS
NPPAQFTWLQNGKSVNNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSK
PTIVTSNNTAVETKDFSMTCNATGQIHAYQWFINGVAPDGRRIQLSPDRRTLTLSSLTRF
DNKGPFVCEIENPLFRNRSDPFPLNVTYGPDIATIVRSAGVYPTGVNITLSCVADSNPPA
QFTWLQNGQSVSNSAIFSVISSLNHAGTYTCIASNSFTGMTRTATKNIIIYGEYLDWATN
FVLGFLFPWYERNRHKIFCLVP
Download sequence
Identical sequences H9H8M6
ENSMODP00000027152 ENSMODP00000040836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]