SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040843 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040843
Domain Number 1 Region: 141-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000164
Family C1 set domains (antibody constant domain-like) 0.066
Further Details:      
 
Domain Number 2 Region: 37-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000145
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040843   Gene: ENSMODG00000028535   Transcript: ENSMODT00000043951
Sequence length 272
Comment pep:novel chromosome:BROADO5:4:73673295:73738152:1 gene:ENSMODG00000028535 transcript:ENSMODT00000043951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQVHERFFCPSSTYSLIWSLTIVMLCWAQGKVITENETVPLERPASLKCSLSTPQEAL
IVTWQKLSKGRPENIATYSMAHGVVIQKPYQNKIEMTQQGLSESTITFLRTTPEDEHCYS
CIFNIFGSEAVSGKTCLKLYVQPKVFLNYEFSGDHLNVTCSAIGRPSPVISWKVSGLVAQ
NTNESNNNLNGTTSVTSTLHIKDFEKWAEKKIVCNVQHMESTMDYNVTPSKGGTGHHVSV
PIMVSVLVSVVLLVTLVIILLYWKYRHQSKGI
Download sequence
Identical sequences K7E4Z1
ENSMODP00000040843 ENSMODP00000040843 XP_007493734.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]