SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040855 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040855
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-48
Family Eukaryotic proteases 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040855   Gene: ENSMODG00000028755   Transcript: ENSMODT00000043963
Sequence length 186
Comment pep:novel chromosome:BROADO5:6:148135829:148144806:-1 gene:ENSMODG00000028755 transcript:ENSMODT00000043963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPVNFNNFVIPICLPAIEDQIVEGNLCWVTGWGQIGEYQPLPPPFTLQELEVPLISPQ
TCDYYYHKESNISPSKTIISSSMICAGFPEGQKDSCLGDSGGPLVCNINDVWFQAGLVSW
GEGCARRYRPGVYTNVIAHKNWILNIVPEAGIIDAAAPGPTRLFLPILLLPILLLLGRAS
FDLEMC
Download sequence
Identical sequences K7E503
ENSMODP00000040855 ENSMODP00000040855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]