SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040874 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040874
Domain Number 1 Region: 29-152
Classification Level Classification E-value
Superfamily SEA domain 7.19e-34
Family SEA domain 0.0005
Further Details:      
 
Domain Number 2 Region: 188-284
Classification Level Classification E-value
Superfamily SEA domain 6.28e-28
Family SEA domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040874   Gene: ENSMODG00000028069   Transcript: ENSMODT00000043982
Sequence length 287
Comment pep:novel chromosome:BROADO5:3:462421425:462663943:-1 gene:ENSMODG00000028069 transcript:ENSMODT00000043982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIFDTYLPDDTIAPSDDSSESTVTSVSQPSYYKIFTLDFTITNMLYKPEMGESGSSTFE
ATEHVLKNLLKVLFERSSLGSQYSGCSVISLRSRNNGTATGVDVYCILKEVSASAVLEKE
KVYWELTEQLFRRKLSHLIIDKDSLSVDGYNRKMTLFRSRKGLFKPNIHKDMKQEMERAG
ETKSQVSAGSSNLKTFTLNFTITNMFYTTTMSQRRSNTFRATEFILQHLFKVLFERSSLG
SQYSGCSVTLLRSMKNGKATGVEVRCSYQEVFSIPVLDKKKIYQTSG
Download sequence
Identical sequences K7E522
ENSMODP00000040874 ENSMODP00000040874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]