SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040955 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040955
Domain Number 1 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000707
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040955
Domain Number - Region: 138-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000117
Family C1 set domains (antibody constant domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040955   Gene: ENSMODG00000028597   Transcript: ENSMODT00000044064
Sequence length 325
Comment pep:novel chromosome:BROADO5:2:169011071:169033710:1 gene:ENSMODG00000028597 transcript:ENSMODT00000044064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMRRILQLLLLFLQSQKGTQKEEAKDSYHTVYGIVGGFILFPLNVSLETEIQEIEWRF
KSEQLQLLSLKPGASSFLWYNPLDRYKERLEILEDSSLIIRNLTPKDSGLYEARVIFNSG
VFIIQTFVLSVYDPIPVPQIHIQSQCLTSFWCNITLDCRVTEPRTAVTVTWKGWNLLSML
EKTEMSEISPNSRILSLSLPRSQSNSSLTCLARNPVDQRNITINLRNICALRDIYASDKA
PKESVNMSSCPIKWMVLWKGLLLLGILSWTLGIRFTQDKEQAEEGRAKKNEVNRTRRHPV
IKNMHTWTDYCPEPHPSDYSVPVGK
Download sequence
Identical sequences K7E5A3
ENSMODP00000040955 XP_007481754.1.35504 ENSMODP00000040955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]