SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040992 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040992
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily SEA domain 3.92e-32
Family SEA domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040992   Gene: ENSMODG00000028519   Transcript: ENSMODT00000044102
Sequence length 105
Comment pep:novel chromosome:BROADO5:Un:100595881:100597759:1 gene:ENSMODG00000028519 transcript:ENSMODT00000044102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYKTKMGQRGSSTFRVAEFVLQHLFKVLFERSSLGSQYSGCSVTLLRSMNNGKATGVIC
SYQEFFSIPVLDKKKIYQELSQQTNGITRLGGYILDEESLYVDGE
Download sequence
Identical sequences K7E5E0
ENSMODP00000040992 XP_007506710.1.35504 ENSMODP00000040992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]