SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041021 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041021
Domain Number 1 Region: 105-230
Classification Level Classification E-value
Superfamily SEA domain 2.22e-35
Family SEA domain 0.001
Further Details:      
 
Domain Number 2 Region: 28-95
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000641
Family SEA domain 0.0049
Further Details:      
 
Domain Number 3 Region: 263-333
Classification Level Classification E-value
Superfamily SEA domain 0.000000085
Family SEA domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041021   Gene: ENSMODG00000028764   Transcript: ENSMODT00000044131
Sequence length 336
Comment pep:novel chromosome:BROADO5:3:481558627:481568377:1 gene:ENSMODG00000028764 transcript:ENSMODT00000044131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDFAEHSWCLLTAAVFGMPTFSRSFTVTSNVSFPRPVQNGTATKFLCGHWKTPTTPSLD
RKKIYRELSNQTQGITRLGAYTLDNKSLYLDGYSYQMNLSSSTSAGGPNFEPFTLKFTIT
NMRYTADMGERGSSIFISTERVLQRLLSSLFEKSSLGSQDFASKLTLLRPMKEGRATLVH
FTCIHRRDPASPVLDREKIYCELSYLTWSITRLGPYTLEKDSLYLNGYNHLAVAPTKMPP
DPAVAPGCPLWATEPGGSQAASLSFQSFTTIPEVLYTEDMHLSGSDKFNFTKRTLQQPLK
NGSASGVSCLCTHKRNHRSSFRDQEKVYGEAKRSFH
Download sequence
Identical sequences K7E5G9
ENSMODP00000041021 ENSMODP00000041021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]