SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041070 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041070
Domain Number 1 Region: 28-127
Classification Level Classification E-value
Superfamily Immunoglobulin 6.45e-28
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041070   Gene: ENSMODG00000028076   Transcript: ENSMODT00000044180
Sequence length 136
Comment pep:novel chromosome:BROADO5:3:433000827:433002684:1 gene:ENSMODG00000028076 transcript:ENSMODT00000044180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAETLTTLARIYLLGLLFSILSGSWAQVKLLESGGKVTHEGQSVTLTCKASGFNFKDYA
MSWHWRPSGSNSQFVAGISSKTGSKTEYKPSIQGRAYITRNNEAHTVSLTLIQLRKEDSG
IYYCVKLTVLGLRQTP
Download sequence
Identical sequences K7E5L8
ENSMODP00000041070 ENSMODP00000041070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]