SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041152 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041152
Domain Number 1 Region: 135-233
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-21
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 50-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000394
Family I set domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041152   Gene: ENSMODG00000027743   Transcript: ENSMODT00000044262
Sequence length 364
Comment pep:novel chromosome:BROADO5:Un:30229639:30243196:-1 gene:ENSMODG00000027743 transcript:ENSMODT00000044262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMSPTVASLLWLGLCLAQIAAAGAQSLPSMASCPSSSSEQKGTSMAGTPKPFIRAEPGS
VVPREAHVRFCCRSTWRSGSFQLWKDGGCSFQINASREQAEGCFPKSVAAAGNYSCRYSR
GLHWSELSAPLQLLVTGHFSKPSLRGQPGTVVSAGDTVTLLCQASPTYHNPKMTFFLLKA
GVPHPVQRLSPEGDVANFTLPSVKAEDAGSYSCICSVGERSSSPSDALHLEVTGGKDAHP
PKPGSDTIVIVTASCVSVFLFLLLFLVFLCCRHTQHCSLHGKAPRRPSSSPGDPEPLRLT
SLPPQEITYAEVSKELQTEPWASESEEPQGVTYTQLSLAALQTGQRAPTATCPEPSVYST
LALH
Download sequence
Identical sequences K7E5V0
ENSMODP00000041152 ENSMODP00000041152 XP_007506165.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]