SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041185 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041185
Domain Number 1 Region: 37-140
Classification Level Classification E-value
Superfamily Immunoglobulin 7.46e-17
Family V set domains (antibody variable domain-like) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041185   Gene: ENSMODG00000029466   Transcript: ENSMODT00000044295
Sequence length 270
Comment pep:novel chromosome:BROADO5:Un:42252808:42271263:1 gene:ENSMODG00000029466 transcript:ENSMODT00000044295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMLWDFPQGWPGCWKGLLFTVTILSSSLQLASLAQLSIVSIPSHGTVGSNITLSVHGIP
KEPQNYSWFRQMPKESNKIVSYAVRSGEQTQGLNHTGRESIFPNGSLFIINVTSNDNGAY
IVQVTTEDSKPVSGQGHLQIHDSPMLSHIGLVASIVLGALAGGVVLGVLGYFLFKRTRGS
ARTIRRDSVRRRRNHPINQNHGGEDIVYENHQWHRGMTLTAQGEGLSSISSRGILEIPDQ
ALDINKMDVYDEVMIWPTVQASEREGNPRR
Download sequence
Identical sequences K7E5Y3
XP_007506392.1.35504 ENSMODP00000041185 ENSMODP00000041185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]