SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041198 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041198
Domain Number 1 Region: 33-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000135
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041198   Gene: ENSMODG00000028871   Transcript: ENSMODT00000044307
Sequence length 274
Comment pep:novel chromosome:BROADO5:6:194527034:194612956:-1 gene:ENSMODG00000028871 transcript:ENSMODT00000044307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTATAASGLDVSRTAVLADGSGDPVPKNRTGQCSRASPPQGGTFQVIAGNGTALGTILM
FHCPIGHQMLGQGIVTCIWRENGTEWTNGTPTCKALPVYETFGFKVAVIASIISCAIILL
MSVAFLTCCLLKCVKKNERRQTERDMQFWYQLRSEELEDMQAAHFGYKGRNNSNNNRARN
MSVSVGENAEAAYDNPGFSRNQEDHVGWRGNNMNTYQQNENDLWSMEQQGQMPHGRHFLP
RVSVGLPTVSTVHLFEISGEDMRIPKKPTTYIPG
Download sequence
Identical sequences K7E5Z6
ENSMODP00000041198 XP_007499736.1.35504 ENSMODP00000041198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]